SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426320 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426320
Domain Number 1 Region: 14-210
Classification Level Classification E-value
Superfamily DNase I-like 1.14e-17
Family DNase I-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426320   Gene: ENSG00000138767   Transcript: ENST00000505983
Sequence length 260
Comment pep:putative chromosome:GRCh37:4:78647320:78663626:-1 gene:ENSG00000138767 transcript:ENST00000505983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKSCHCQVAAASNQEVETEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAI
FFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKP
IHAADKQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPL
VLCADLNSLPDSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQ
LKSAYENNLMPYTNYTFDFK
Download sequence
Identical sequences A0A2J8PFY0 A0A2J8UUD6 H0YA76
ENSP00000426320 ENSP00000426320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]