SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426543 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426543
Domain Number 1 Region: 109-209
Classification Level Classification E-value
Superfamily RNI-like 0.00000628
Family 28-residue LRR 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426543   Gene: ENSG00000170458   Transcript: ENST00000498971
Sequence length 213
Comment pep:putative chromosome:GRCh37:5:140011929:140013236:-1 gene:ENSG00000170458 transcript:ENST00000498971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLM
Download sequence
Identical sequences D6RFL4
ENSP00000426543 ENSP00000426543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]