SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426561 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426561
Domain Number 1 Region: 6-43
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000256
Family Protein kinases, catalytic subunit 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426561   Gene: ENSG00000134058   Transcript: ENST00000510106
Sequence length 43
Comment pep:known chromosome:GRCh37:5:68530725:68568778:1 gene:ENSG00000134058 transcript:ENST00000510106 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKV
Download sequence
Identical sequences A0A2J8L101 A0A2J8VTT7 D6RFL0
ENSP00000426561 ENSP00000461868 ENSP00000426561 ENSP00000479440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]