SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427059 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427059
Domain Number 1 Region: 48-418
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.48e-111
Family Pyridoxal-dependent decarboxylase 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427059   Gene: ENSG00000144644   Transcript: ENST00000454381
Sequence length 418
Comment pep:putative chromosome:GRCh37:3:30839169:30936153:-1 gene:ENSG00000144644 transcript:ENST00000454381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDSDRQCPVDGDIDQQEMIPSKKNAVLVDGVVLNGPTTDAKAGEKFVEEACRLIMEEV
VLKATDVNEKVCEWRPPEQLKQLLDLEMRDSGEPPHKLLELCRDVIHYSVKTNHPRFFNQ
LYAGLDYYSLVARFMTEALNPSVYTYEVSPVFLLVEEAVLKKMIEFIGWKEGDGIFNPGG
SVSNMYAMNLARYKYCPDIKEKGLSGSPRLILFTSAECHYSMKKAASFLGIGTENVCFVE
TDGRGKMIPEELEKQVWQARKEGAAPFLVCATSGTTVLGAFDPLDEIADICERHSLWLHV
DASWGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDKSDLLKKCYSAK
ASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTLGLEERVNRALALSRY
Download sequence
Identical sequences ENSP00000427059 ENSP00000427059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]