SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427084 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427084
Domain Number 1 Region: 2-35
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000249
Family HLH, helix-loop-helix DNA-binding domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427084   Gene: ENSG00000164107   Transcript: ENST00000503024
Sequence length 92
Comment pep:known chromosome:GRCh37:4:174446120:174450063:-1 gene:ENSG00000164107 transcript:ENST00000503024 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKEL
NEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Download sequence
Identical sequences H0YAH1
ENSP00000427084 ENSP00000427084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]