SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427802 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000427802
Domain Number - Region: 179-213
Classification Level Classification E-value
Superfamily UBA-like 0.00548
Family UBA domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427802   Gene: ENSG00000253506   Transcript: ENST00000521764
Sequence length 215
Comment pep:known chromosome:GRCh37:17:59667794:59668563:-1 gene:ENSG00000253506 transcript:ENST00000521764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEID
EEPVGKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAY
IVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKD
VKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
Download sequence
Identical sequences Q9H009
ENSP00000427802 ENSP00000427802 ENSP00000427802 gi|40548328|ref|NP_954984.1| GO.46346 HR4845 NP_954984.1.87134 NP_954984.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]