SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427977 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427977
Domain Number 1 Region: 271-347
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.87e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0000299
Further Details:      
 
Domain Number 2 Region: 173-252
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.08e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.00031
Further Details:      
 
Domain Number 3 Region: 52-167
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000000173
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 
Domain Number 4 Region: 5-53
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000215
Family Double-stranded RNA-binding domain (dsRBD) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427977   Gene: ENSG00000040341   Transcript: ENST00000522509
Sequence length 479
Comment pep:known chromosome:GRCh37:8:74463878:74659943:-1 gene:ENSG00000040341 transcript:ENST00000522509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPG
SITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQLTV
GNNEFFGEGKTRQAARHNAAMKALQALQNEPIPERSPQNGESGKDVDDDKDANKSEISLV
FEIALKRNMPVSFEVIKESGPPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQEL
KKLPPLPVVEKPKLFFKKRPKTIVKAGPEYGQGMNPISRLAQIQQAKKEKEPDYVLLSER
GMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENK
GWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASRHKVISGTTLGYLSPKDMNQPSSSFF
SISPTSNSSATIARELLMNGTSSTAEAIGLKGSSPTPPCSPVQPSKQLEYLARIQGFQV
Download sequence
Identical sequences F8VPI7
ENSP00000348026 ENSP00000427977 gi|256418993|ref|NP_055208.2| gi|256419003|ref|NP_001157856.1| ENSP00000348026 ENSP00000427977 9606.ENSP00000348026 NP_001157856.1.87134 NP_001157856.1.92137 NP_055208.2.87134 NP_055208.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]