SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000428110 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428110
Domain Number 1 Region: 4-293
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.05e-93
Family Hect, E3 ligase catalytic domain 0.000000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428110   Gene: ENSG00000085382   Transcript: ENST00000518402
Sequence length 300
Comment pep:novel chromosome:GRCh37:6:105176917:105224966:-1 gene:ENSG00000085382 transcript:ENST00000518402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREWFDILSNEIVNPDYALFTQSADGTTF
QPNSNSYVNPDHLNYFRFAGQILGLALNHRQLVNIYFTRSFYKHILGIPVNYQDVASIDP
EYAKNLQWILDNDISDLGLELTFSVETDVFGAMEEVPLKPGGGSILVTQNNKELLLSGMP
EIDVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANI
MGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA
Download sequence
Identical sequences H0YAU8
ENSP00000428110 ENSP00000428110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]