SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000428226 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428226
Domain Number 1 Region: 3-86,130-171
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000001
Family Rna1p (RanGAP1), N-terminal domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428226   Gene: ENSG00000249437   Transcript: ENST00000514857
Sequence length 193
Comment pep:putative chromosome:GRCh37:5:70266074:70272055:-1 gene:ENSG00000249437 transcript:ENST00000514857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XISLKILNLEGQQFPDEETSEKFAYILGSLSNLEELILPTGDGIYRVAKLIIQQCQQLHC
LRVLSFFKTLNDDSVVEIDGVLLCHPGWSAVVGFWLTATSTSQVQADSPASASRVAGITA
KVAISGGFQKLENLKLSINHKITEEGYRNFFQALDNMPNLQELDISRHFTECIKAQATTV
KSLSQCVLRLPRL
Download sequence
Identical sequences H0YAX2
ENSP00000428226 ENSP00000460110 ENSP00000428226 ENSP00000479321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]