SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000428416 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428416
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.17e-32
Family Arylamine N-acetyltransferase 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428416   Gene: ENSG00000156006   Transcript: ENST00000520116
Sequence length 160
Comment pep:putative chromosome:GRCh37:8:18248797:18258503:1 gene:ENSG00000156006 transcript:ENST00000520116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIY
LFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNT
DLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLTI
Download sequence
Identical sequences E7EWF9
ENSP00000428416 ENSP00000428416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]