SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000428979 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428979
Domain Number 1 Region: 22-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000191
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 122-159
Classification Level Classification E-value
Superfamily vWA-like 0.00000000378
Family Integrin A (or I) domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428979   Gene: ENSG00000160255   Transcript: ENST00000522931
Sequence length 160
Comment pep:known chromosome:GRCh37:21:46323299:46334198:-1 gene:ENSG00000160255 transcript:ENST00000522931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEI
Download sequence
Identical sequences E5RK25
ENSP00000428979 ENSP00000428979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]