SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429145 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429145
Domain Number 1 Region: 69-438
Classification Level Classification E-value
Superfamily RNI-like 9.42e-61
Family 28-residue LRR 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429145   Gene: ENSG00000114248   Transcript: ENST00000523069
Sequence length 443
Comment pep:putative chromosome:GRCh37:3:169557759:169587621:-1 gene:ENSG00000114248 transcript:ENST00000523069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTRKKTSSEGETKPQTSTVNKFLRGSNAESRKEDNDLKTSDSQPSDWIQKTATSETAK
PLSSEMEWRSSMEKNEHFLQKLGKKAVNKCLDLNNCGLTTADMKEMVALLPFLPDLEELD
ISWNGFVGGTLLSITQQMHLVSKLKILRLGSCRLTTDDVQALGEAFEMIPELEELNLSWN
SKVGGNLPLILQKFQKGSKIQMIELVDCSLTSEDGTFLGQLLPMLQSLEVLDLSINRDIV
GSLNSIAQGLKSTSNLKVLKLHSCGLSQKSVKILDAAFRYLGELRKLDLSCNKDLGGGFE
DSPAQLVMLKHLQVLDLHQCSLTADDVMSLTQVIPLLSNLQELDLSANKKMGSSSENLLS
RLRFLPALKSLVINNCALESETFTALAEASVHLSALEVFNLSWNKCVGGNLKLLLETLKL
SMSLQVLRLSSCSLVTEDVALLE
Download sequence
Identical sequences ENSP00000429145 ENSP00000429145 NP_001264056.1.87134 NP_001264056.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]