SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429253 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000429253
Domain Number - Region: 3-13,61-67
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000837
Family Formin homology 2 domain (FH2 domain) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429253   Gene: ENSG00000066855   Transcript: ENST00000521247
Sequence length 144
Comment pep:putative chromosome:GRCh37:8:66619280:66683496:1 gene:ENSG00000066855 transcript:ENST00000521247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHPPPPPPPLPPPALGLHQSTSAVDLIKERREKRANAGKTLVKNNPKKPEMPNMLEILKE
MNSVKLRSVKRSEQDVKPKPVDATDPAALIAEALKKKFAYRYRSDSQDEVEKGIPKSESE
ATSERVLSLPAGFIQPHVSKHCLG
Download sequence
Identical sequences H7C5V5
ENSP00000429253 ENSP00000429253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]