SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429593 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429593
Domain Number 1 Region: 45-364
Classification Level Classification E-value
Superfamily RNI-like 2.26e-62
Family 28-residue LRR 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429593   Gene: ENSG00000171757   Transcript: ENST00000522830
Sequence length 403
Comment pep:putative chromosome:GRCh37:3:169511261:169530720:-1 gene:ENSG00000171757 transcript:ENST00000522830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSQKINPFILHILQEVDEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILKN
CLYINGLDVGYNLLCDVGAYYAAKLLQKQLNLIYLNLMFNDIGPEGGELIAKVLHKNRTL
KYLRMTGNKIENKGGMFFAAMLQINSSLEKLDLGDCDLGMQSVIAFATVLTQNQAIKAIN
LNRPILYSEQEESTVHVGRMLKENHCLVALHMCKHDIKNSGIQQLCDALYLNSSLRYLDV
SCNKITHDGMVYLADVLKSNTTLEVIDLSFNRIENAGANYLSETLTSHNRSLKALSVVSN
NIEGEGLVALSQSMKTNLTFSHIYIWGNKFDEATCIAYSDLIQMGCLKPDNTDVEPFVVD
GRVYLAEVSNGLKKHYYWTSTYGESYDHSSNAGFALVPVGQQP
Download sequence
Identical sequences G3V115
ENSP00000429593 ENSP00000429593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]