SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429656 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000429656
Domain Number - Region: 32-101
Classification Level Classification E-value
Superfamily Mitochondrial carrier 0.0183
Family Mitochondrial carrier 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429656   Gene: ENSG00000104660   Transcript: ENST00000520682
Sequence length 162
Comment pep:novel chromosome:GRCh37:8:29952936:29989699:1 gene:ENSG00000104660 transcript:ENST00000520682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTD
AMSNACKELAIFLTTGIVVSAFGLPIVFARAHLQKQNTVHHGKDTVVRITEQPERGETPD
LHSQHDVGNDQLGVGPGEGSIEQPHRPGSDKLIGKGVNQVVS
Download sequence
Identical sequences E5RHU8
ENSP00000429656 ENSP00000429656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]