SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430235 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430235
Domain Number 1 Region: 367-449
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.24e-17
Family HLH, helix-loop-helix DNA-binding domain 0.00000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430235   Gene: ENSG00000136997   Transcript: ENST00000524013
Sequence length 453
Comment pep:novel chromosome:GRCh37:8:128748466:128753618:1 gene:ENSG00000136997 transcript:ENST00000524013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDFFRVVENQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPS
EDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELL
GGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPAR
GHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSS
TESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGG
HSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPR
SSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSV
QAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Download sequence
Identical sequences H0YBT0
ENSP00000430235 ENSP00000430235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]