SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430490 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430490
Domain Number 1 Region: 7-46
Classification Level Classification E-value
Superfamily F-box domain 0.000000000128
Family F-box domain 0.0047
Further Details:      
 
Domain Number 2 Region: 128-204,317-355
Classification Level Classification E-value
Superfamily RNI-like 0.0000000373
Family Rna1p (RanGAP1), N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430490   Gene: ENSG00000135722   Transcript: ENST00000519917
Sequence length 374
Comment pep:known chromosome:GRCh37:16:67193864:67198077:1 gene:ENSG00000135722 transcript:ENST00000519917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGML
PPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAG
RDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGP
GSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNE
AWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYA
ATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLK
LTREPHPWRPTLVA
Download sequence
Identical sequences Q96CD0
ENSP00000258200 9606.ENSP00000258200 ENSP00000258200 ENSP00000430490 ENSP00000258200 ENSP00000430490 NP_060848.2.87134 NP_060848.2.92137 gi|22547146|ref|NP_060848.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]