SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430842 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430842
Domain Number 1 Region: 34-76
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000641
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430842   Gene: ENSG00000063438   Transcript: ENST00000515206
Sequence length 139
Comment pep:putative chromosome:GRCh37:5:322755:368107:1 gene:ENSG00000063438 transcript:ENST00000515206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQGQGLAVADAEDVDDHTGERRPMSFRRPRALDTQALRRTQ
FGLHLLMVNIAGLIATDRL
Download sequence
Identical sequences G3V143
ENSP00000430842 ENSP00000430842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]