SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430968 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430968
Domain Number 1 Region: 557-636
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000034
Family F-box domain 0.0045
Further Details:      
 
Domain Number 2 Region: 651-825
Classification Level Classification E-value
Superfamily RNI-like 0.000000235
Family Cyclin A/CDK2-associated p19, Skp2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430968   Gene: ENSG00000163013   Transcript: ENST00000520530
Sequence length 875
Comment pep:known chromosome:GRCh37:2:73485734:73511438:-1 gene:ENSG00000163013 transcript:ENST00000520530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLDLPYRCPRCGEHKRFRSLSSLRAHLEYSHTYETLYILSKTNSICDGAAAAAAAAAA
ASGFPLAPEPAALLAVPGARREVFESTSFQGKEQAAGPSPAAPHLLHHHHHHAPLAHFPG
DLVPASLPCEELAEPGLVPAAAARYALREIEIPLGELFARKSVASSACSTPPPGPGPGPC
PGPASASPASPSPADVAYEEGLARLKIRALEKLEVDRRLERLSEEVEQKIAGQVGRLQAE
LERKAAELETARQESARLGREKEELEERASELSRQVDVSVELLASLKQDLVHKEQELSRK
QQEVVQIDQFLKETAAREASAKLRLQQFIEELLERADRAERQLQVISSSCGSTPSASLGR
GGGGGGAGPNARGPGRMREHHVGPAVPNTYAVSRHGSSPSTGASSRVPAASQSSGCYDSD
SLELPRPEEGAPEDSGPGGLGTRAQAANGGSERSQPPRSSGLRRQAIQNWQRRPRRHSTE
GEEGDVSDVGSRTTESEAEGPLDAPRPGPAMAGPLSSCRLSARPEGGSGRGRRAERVSPS
RSNEVISPEILKMRAALFCIFTYLDTRTLLHAAEVCRDWRFVARHPAVWTRVLLENARVC
SKFLAMLAQWCTQAHSLTLQNLKPRQRGKKESKEEYARSTRGCLEAGLESLLKAAGGNLL
ILRISHCPNILTDRSLWLASCYCRALQAVTYRSATDPVGHEVIWALGAGCREIVSLQVAP
LHPCQQPTRFSNRCLQMIGRCWPHLRALGVGGAGCGVQGLASLARNCMRLQVLELDHVSE
ITQEVAAEVCREGLKGLEMLVLTATPVTPKALLHFNSICRNLKSIVVQIGIADYFKEPSS
PEAQKLFEDMVTKLQALRRRPGFSKILHIKVEGGC
Download sequence
Identical sequences Q8TF61
ENSP00000428646 ENSP00000430968 ENSP00000295133 ENSP00000428646 ENSP00000430968 gi|289803020|ref|NP_001073879.2| NP_001073879.2.87134 NP_001073879.2.92137 XP_006712013.1.92137 XP_011530864.1.92137 XP_016858910.1.92137 XP_016858911.1.92137 XP_016858912.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]