SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431377 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431377
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.13e-16
Family Tandem AAA-ATPase domain 0.0000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431377   Gene: ENSG00000237889   Transcript: ENST00000493350
Sequence length 141
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_APD:31509287:31514543:-1 gene:ENSG00000237889 transcript:ENST00000493350 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVK
LKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEESLK
IFNDEFLWLPTYLAEAWTSSG
Download sequence
Identical sequences H0YCC6
ENSP00000431377 ENSP00000431969 ENSP00000432296 ENSP00000433192 ENSP00000433234 ENSP00000434615 ENSP00000434736 ENSP00000436220 ENSP00000431377 ENSP00000431969 ENSP00000432296 ENSP00000433192 ENSP00000433234 ENSP00000434615 ENSP00000434736 ENSP00000436220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]