SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431789 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431789
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily POZ domain 7.65e-33
Family Tetramerization domain of potassium channels 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431789   Gene: ENSG00000188997   Transcript: ENST00000526208
Sequence length 165
Comment pep:known chromosome:GRCh37:11:77885105:77899634:-1 gene:ENSG00000188997 transcript:ENST00000526208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYIL
NFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRV
QTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFY
Download sequence
Identical sequences A0A2J8MBP1 A0A2J8V0P3 E9PJJ5
ENSP00000431789 ENSP00000431789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]