SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000432055 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432055
Domain Number 1 Region: 12-77
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000269
Family VWC domain 0.016
Further Details:      
 
Domain Number 2 Region: 89-131
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000164
Family Fibronectin type I module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432055   Gene: ENSG00000054938   Transcript: ENST00000534276
Sequence length 142
Comment pep:known chromosome:GRCh37:11:74413839:74430348:-1 gene:ENSG00000054938 transcript:ENST00000534276 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MALVGLPGPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLRCTCSEGAHVSCYRLHCPPVH
CPQPVTEPQQCCPKCVEPHTPSGLRAPPKSCQHNGTMYQHGEIFSAHELFPSRLPNQCVL
CSCTMRQVSNRMKRTVCSRSMG
Download sequence
Identical sequences ENSP00000432055 ENSP00000432055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]