SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000432170 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432170
Domain Number 1 Region: 2-226
Classification Level Classification E-value
Superfamily RNI-like 2.92e-54
Family 28-residue LRR 0.0000000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432170   Gene: ENSG00000023191   Transcript: ENST00000529768
Sequence length 285
Comment pep:novel chromosome:GRCh37:11:494544:498929:-1 gene:ENSG00000023191 transcript:ENST00000529768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESCGVTSDNCRDLCGIVASKASLRELALGSNKLGDVGMAELCPGLLHPSSRLRTLWIWEC
GITAKGCGDLCRVLRAKESLKELSLAGNELGDEGARLLCETLLEPGCQLESLWVKSCSFT
AACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQGLGQPGSVLRVLWLADCDVSDSS
CSSLAATLLANHSLRELDLSNNCLGDAGILQLVESVRQPGCLLEQLVYVHALGGWCGQGC
PGRKAGVGEDTGPCLPSGLCAACTTFTGLRRWRTGCRPWRRTSHP
Download sequence
Identical sequences H0YCR7
ENSP00000432170 ENSP00000432170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]