SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000432668 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432668
Domain Number 1 Region: 160-210
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000051
Family CUE domain 0.00059
Further Details:      
 
Weak hits

Sequence:  ENSP00000432668
Domain Number - Region: 55-111
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0235
Family PLC-like (P variant) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432668   Gene: ENSG00000078902   Transcript: ENST00000525159
Sequence length 213
Comment pep:novel chromosome:GRCh37:11:1295603:1330849:-1 gene:ENSG00000078902 transcript:ENST00000525159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVV
QRAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVM
PPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKAIQDMF
PNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP
Download sequence
Identical sequences A0A2I3N748 A0A2J8S6U5 A0A2K5LQI0 A0A2K6R0Y2 F2Z2Y8 M3ZB90
ENSP00000432668 NP_001305445.1.87134 NP_001305445.1.92137 XP_004087920.1.23891 ENSP00000432668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]