SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000433423 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433423
Domain Number 1 Region: 261-519
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-86
Family Protein kinases, catalytic subunit 0.000000000248
Further Details:      
 
Weak hits

Sequence:  ENSP00000433423
Domain Number - Region: 79-182
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0418
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433423   Gene: ENSG00000149269   Transcript: ENST00000530617
Sequence length 522
Comment pep:putative chromosome:GRCh37:11:77033062:77123109:-1 gene:ENSG00000149269 transcript:ENST00000530617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHSSRL
Download sequence
Identical sequences A0A2J8MBK9 B3KNX7
ENSP00000433423 ENSP00000433423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]