SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000433571 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433571
Domain Number 1 Region: 72-129
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.88e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433571   Gene: ENSG00000133794   Transcript: ENST00000529388
Sequence length 135
Comment pep:known chromosome:GRCh37:11:13299349:13381919:1 gene:ENSG00000133794 transcript:ENST00000529388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEA
Download sequence
Identical sequences A0A2J8P5D2 A0A2J8UQ52 E9PKF0
ENSP00000433571 ENSP00000433571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]