SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000433586 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433586
Domain Number 1 Region: 26-490
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.89e-71
Family AAT-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433586   Gene: ENSG00000167701   Transcript: ENST00000528431
Sequence length 496
Comment pep:known chromosome:GRCh37:8:145728356:145732557:1 gene:ENSG00000167701 transcript:ENST00000528431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPF
TEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSL
GAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRT
GVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVI
NPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPY
AGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDL
VVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQL
PPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLL
LEKLSRFHAKFTLEYS
Download sequence
Identical sequences P24298
ENSP00000378408 ENSP00000378408 ENSP00000433586 gi|4885351|ref|NP_005300.1| Hs4885351___KOG0258 ENSP00000378408 ENSP00000433586 NP_005300.1.87134 NP_005300.1.92137 XP_011515295.1.92137 9606.ENSP00000378408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]