SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000433599 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433599
Domain Number 1 Region: 10-172
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.18e-30
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433599   Gene: ENSG00000198431   Transcript: ENST00000527335
Sequence length 175
Comment pep:known chromosome:GRCh37:12:104682673:104713351:1 gene:ENSG00000198431 transcript:ENST00000527335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCV
NVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVAL
REKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKE
Download sequence
Identical sequences E9PKD3
ENSP00000433599 ENSP00000433599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]