SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434156 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000434156
Domain Number - Region: 68-137
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000156
Family GABA-aminotransferase-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434156   Gene: ENSG00000110455   Transcript: ENST00000524990
Sequence length 139
Comment pep:known chromosome:GRCh37:11:44087729:44095067:1 gene:ENSG00000110455 transcript:ENST00000524990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDT
SYLSSRGRMIKWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSWRLSQR
DMQRVEPSLLQYADWRGHL
Download sequence
Identical sequences E9PRT9
ENSP00000434156 ENSP00000434156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]