SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434263 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000434263
Domain Number - Region: 28-46
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00276
Family HLH, helix-loop-helix DNA-binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434263   Gene: ENSG00000133794   Transcript: ENST00000529825
Sequence length 46
Comment pep:known chromosome:GRCh37:11:13299341:13380028:1 gene:ENSG00000133794 transcript:ENST00000529825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMN
Download sequence
Identical sequences A0A2J8P5D7 A0A2J8UQ17 E9PRB1
ENSP00000434263 ENSP00000434263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]