SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434301 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434301
Domain Number 1 Region: 56-124
Classification Level Classification E-value
Superfamily UBA-like 2.81e-27
Family TAP-C domain-like 0.0000267
Further Details:      
 
Domain Number 2 Region: 4-59
Classification Level Classification E-value
Superfamily NTF2-like 0.000000000555
Family NTF2-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434301   Gene: ENSG00000162231   Transcript: ENST00000527902
Sequence length 124
Comment pep:novel chromosome:GRCh37:11:62559703:62563554:-1 gene:ENSG00000162231 transcript:ENST00000527902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGSEEIQRAFAMPAPTP
SSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEV
AFMK
Download sequence
Identical sequences H0YDU0
ENSP00000434301 ENSP00000434301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]