SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434322 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434322
Domain Number 1 Region: 2-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-22
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434322   Gene: ENSG00000181135   Transcript: ENST00000533031
Sequence length 55
Comment pep:known chromosome:GRCh37:8:144766626:144777526:1 gene:ENSG00000181135 transcript:ENST00000533031 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MDMAQEPVTFRDVAIYFSREEWACLEPSQRALYRDVMLDNFSSVAALGEHGLSAA
Download sequence
Identical sequences E9PJ46
ENSP00000393748 ENSP00000434215 ENSP00000434322 ENSP00000434791 ENSP00000435679 ENSP00000393748 ENSP00000434215 ENSP00000434322 ENSP00000434791 ENSP00000435679 ENSP00000455222 ENSP00000456674 ENSP00000456700 ENSP00000457481 ENSP00000457918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]