SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434328 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434328
Domain Number 1 Region: 48-186
Classification Level Classification E-value
Superfamily C-type lectin-like 6.58e-31
Family C-type lectin domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434328   Gene: ENSG00000204381   Transcript: ENST00000525126
Sequence length 270
Comment pep:putative chromosome:GRCh37:11:111411434:111431658:1 gene:ENSG00000204381 transcript:ENST00000525126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGTALQAVLLAVLLVGLRAATGRLLSASDLDLRGGQPVCRGGTQRPCYKVIYFHDTSR
RLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLLPSDGDFWIGLRRREEKQSNSTA
CQDLYAWTDGSISQFRNWYVDEPSCGSEVCVVMYHQPSAPAGIGGPYMFQWNDDRCNMKN
NFICKYSDEKPAVPSREAEGEETELTTPVLPEETQEEDAKKTFKESREAALNLAYILIPS
IPLLLLLVVTTVVCWVWICRKRQKTGAARP
Download sequence
Identical sequences E9PQU7
ENSP00000434328 ENSP00000434328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]