SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434696 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434696
Domain Number 1 Region: 111-374
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.81e-72
Family Pyridoxal-dependent decarboxylase 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434696   Gene: ENSG00000128683   Transcript: ENST00000493875
Sequence length 425
Comment pep:known chromosome:GRCh37:2:171674280:171717661:1 gene:ENSG00000128683 transcript:ENST00000493875 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEQSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDGFNFSQLANRIICLATELMTNKGCVTWHPNYSVNMHHGCLGRWAAHV
QEAPP
Download sequence
Identical sequences G3RKD2
ENSP00000434696 ENSP00000434696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]