SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434897 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434897
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0000000000107
Family Pyk2-associated protein beta ARF-GAP domain 0.00015
Further Details:      
 
Domain Number 2 Region: 72-111
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000152
Family Ankyrin repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434897   Gene: ENSG00000088280   Transcript: ENST00000484418
Sequence length 124
Comment pep:known chromosome:GRCh37:1:23759696:23763461:-1 gene:ENSG00000088280 transcript:ENST00000484418 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIM
AKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQVRTPPRATY
NPPV
Download sequence
Identical sequences H0YE36
ENSP00000434897 ENSP00000434897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]