SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000435625 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435625
Domain Number 1 Region: 153-290
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.19e-25
Family UBX domain 0.011
Further Details:      
 
Domain Number 2 Region: 6-54
Classification Level Classification E-value
Superfamily UBA-like 7.66e-17
Family UBA domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435625   Gene: ENSG00000162191   Transcript: ENST00000534176
Sequence length 290
Comment pep:known chromosome:GRCh37:11:62444085:62446553:-1 gene:ENSG00000162191 transcript:ENST00000534176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHIL
GREPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
LYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLI
Download sequence
Identical sequences E9PJ81
ENSP00000435625 ENSP00000435625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]