SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000435798 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435798
Domain Number 1 Region: 5-148
Classification Level Classification E-value
Superfamily RNI-like 1.18e-32
Family 28-residue LRR 0.000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435798   Gene: ENSG00000023191   Transcript: ENST00000531149
Sequence length 181
Comment pep:putative chromosome:GRCh37:11:499501:507259:-1 gene:ENSG00000023191 transcript:ENST00000531149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAE
LNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHL
SDNLLGDAGLQLLCEGLLDPQCRLEKLHCPLQGTAAPGPDGGNRCLAVSQVPLTASVCVG
D
Download sequence
Identical sequences E9PIK5
ENSP00000435798 ENSP00000435798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]