SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000436452 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000436452
Domain Number - Region: 194-298
Classification Level Classification E-value
Superfamily RNI-like 0.000419
Family Cyclin A/CDK2-associated p19, Skp2 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436452   Gene: ENSG00000160959   Transcript: ENST00000527730
Sequence length 301
Comment pep:putative chromosome:GRCh37:8:145743376:145746195:1 gene:ENSG00000160959 transcript:ENST00000527730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTLVFLSTRQVLQCQPAACQALPLLPRELFPLLFKVAFMDKKTVVLRELVHTWPFPLLS
FQQLLQECAHCSRALLQERPSTESMQAVILGLTARLHTSEPGASTQPLCRKHALRVLDMT
GLLDDGVEQDPGTMSMWDCTAAVARTCIAQQQGGAAEPGPAPIPVEVRVDLRVNRASYAF
LREALRSSVGSPLRLCCRDLRAEDLPMRNTVALLQLLDAGCLRRVDLRFNNLGLRGLSVI
IPHVARFQHLASLRLHYVHGDSRQPSVDGEDNFRYFLAQMGRFTCLRELSMGSSLLSGRL
D
Download sequence
Identical sequences A0A2J8PXC0 A0A2J8RHV2 E9PP40
ENSP00000436452 ENSP00000436452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]