SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000436883 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436883
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000432
Family 28-residue LRR 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436883   Gene: ENSG00000171757   Transcript: ENST00000528597
Sequence length 56
Comment pep:putative chromosome:GRCh37:3:169511315:169514687:-1 gene:ENSG00000171757 transcript:ENST00000528597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EESTVHVGRMLKENHCLVALHMCKHDIKNSGIQQLCDALYLNSSLRYLDVSWHIQT
Download sequence
Identical sequences A0A2J8P1K7 A0A2J8TIA8 H0YEZ4
ENSP00000436883 ENSP00000436883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]