SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437246 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437246
Domain Number 1 Region: 6-166
Classification Level Classification E-value
Superfamily RNI-like 4.15e-36
Family 28-residue LRR 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437246   Gene: ENSG00000167207   Transcript: ENST00000534057
Sequence length 169
Comment pep:novel chromosome:GRCh37:16:50746105:50757285:1 gene:ENSG00000167207 transcript:ENST00000534057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLNVGHLKLTFCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKAL
YLRDNNISDRGICKLIECALHCEQLQKLALGNNYITAAGAQVLAEGLRGNTSLQFLGFWG
NRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVML
Download sequence
Identical sequences H0YF53
ENSP00000437246 ENSP00000437246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]