SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437404 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437404
Domain Number 1 Region: 19-122
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.59e-18
Family PLC-like (P variant) 0.05
Further Details:      
 
Domain Number 2 Region: 171-221
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000553
Family CUE domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437404   Gene: ENSG00000078902   Transcript: ENST00000542915
Sequence length 224
Comment pep:known chromosome:GRCh37:11:1296886:1330853:-1 gene:ENSG00000078902 transcript:ENST00000542915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTVSTQRGPAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPP
GVDSFYLEIFDERAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVM
SYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCS
EEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP
Download sequence
Identical sequences B3KR28
NP_001305441.1.87134 NP_001305441.1.92137 XP_004087919.1.23891 ENSP00000437404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]