SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437450 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437450
Domain Number 1 Region: 10-46
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000168
Family UBA domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437450   Gene: ENSG00000048028   Transcript: ENST00000544750
Sequence length 46
Comment pep:putative chromosome:GRCh37:11:113723344:113746255:-1 gene:ENSG00000048028 transcript:ENST00000544750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNYICRTKLADRYPQSCQMLLNQLREITGIQDPSFLHEALKASNG
Download sequence
Identical sequences F5H6Q3
ENSP00000437450 ENSP00000437450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]