SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437583 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437583
Domain Number 1 Region: 52-316
Classification Level Classification E-value
Superfamily RNI-like 2.13e-28
Family 28-residue LRR 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437583   Gene: ENSG00000140853   Transcript: ENST00000537056
Sequence length 325
Comment pep:known chromosome:GRCh37:16:57077493:57117436:1 gene:ENSG00000140853 transcript:ENST00000537056 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XWLFRLDISFESQHILLRGDKTSRDMWATGSLPDFPAAAKFLGFRQRCIPRSLCLSECPL
EPPSLTRLCATLKDCPGPLELQLSCEFLSDQSLETLLDCLPQLPQLSLLQLSQTGLSPKS
PFLLANTLSLCPRVKKVDLRSLHHATLHFRSNEEEEGVCCGFTGCSLSQEHVESLCWLLS
KCKDLSQVDLSANLLGDSGLRCLLECLPQVPISGLLDLSHNSISQESALYLLETLPSCPR
VREASVNLGSEQSFRIHFSREDQAGKTLRLSECSFRPEHVSRLATGLSKSLQLTELTLTQ
CCLGQKQLAILLSLVGRPAGLFSLS
Download sequence
Identical sequences H0YF88
ENSP00000437583 ENSP00000437583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]