SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437637 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437637
Domain Number 1 Region: 143-389
Classification Level Classification E-value
Superfamily DNase I-like 4.71e-42
Family DNase I-like 0.023
Further Details:      
 
Domain Number 2 Region: 56-93
Classification Level Classification E-value
Superfamily UBA-like 0.0000128
Family TAP-C domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437637   Gene: ENSG00000111802   Transcript: ENST00000545995
Sequence length 392
Comment pep:known chromosome:GRCh37:6:24650206:24667180:-1 gene:ENSG00000111802 transcript:ENST00000545995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRERHDTGACAEPRVGLLFRLKGRCRGGRKMELGSCLEGGREAAEEEGEPEVKKRRLLCV
EFASVASCDAAVAQCFLAENDWEMERALNSYFEPPVEESALERRPETISEPKTYVDLTNE
ETTDSTTSKISPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFL
QEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTKMMRNLLC
VHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQEAPESATVIFAGDTNLRDREV
TRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHII
PRSLDLLGLEKLDCGRFPSDHWGLLCNLDIIL
Download sequence
Identical sequences ENSP00000437637 ENSP00000437637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]