SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437743 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437743
Domain Number 1 Region: 140-302
Classification Level Classification E-value
Superfamily RNI-like 1.22e-45
Family 28-residue LRR 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437743   Gene: ENSG00000128872   Transcript: ENST00000539962
Sequence length 307
Comment pep:putative chromosome:GRCh37:15:52043794:52102328:1 gene:ENSG00000128872 transcript:ENST00000539962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKP
IETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVR
NVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALET
NTHVKKFSLAATRSNDPVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTL
TEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKK
RVEADRR
Download sequence
Identical sequences G5EA42
ENSP00000437743 ENSP00000437743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]