SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437821 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437821
Domain Number 1 Region: 449-681
Classification Level Classification E-value
Superfamily RNI-like 2.35e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.022
Further Details:      
 
Domain Number 2 Region: 22-100
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000013
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437821   Gene: ENSG00000089094   Transcript: ENST00000542973
Sequence length 704
Comment pep:putative chromosome:GRCh37:12:121867312:121947509:-1 gene:ENSG00000089094 transcript:ENST00000542973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLMECSICN
EIIHPGCLKIKESEGVVNDELPNCWECPKCNHAGKTGKQKRGPGFKYASNLPGSLLKEQK
MNRDNKEGQEPAKRRSECEEAPRRRSDEHSKKVPPDGLLRRKSDDVHLRKKRKYEKPQEL
SGRKRASSLQTSPGSSSHLSPRPPLGSSLSPWWRSSLTYFQQQLKPGKEDKLFRKKRRSW
KNAEDRMALANKPLRRFKQEPEDELPEAPPKTRESDHSRSSSPTAGPSTEGAEGPEEKKK
VKMRRKRRLPNKELSRELSKELNHEIQRTENSLANENQQPIKSEPESEGEEPKRPPGICE
RPHRFSKGLNGTPRELRHQLGPSLRSPPRVISRPPPSVSPPKCIQMERHVIRPPPISPPP
DSLPLDDGAAHVMHREVWMAVFSYLSHQDLCVCMRVCRTWNRWCCDKRLWTRIDLNHCKS
ITPLMLSGIIRRQPVSLDLSWTNISKKQLSWLINRLPGLRDLVLSGCSWIAVSALCSSSC
PLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDITDASLRL
IIRHMPLLSKLHLSYCNHVTDQSINLLTAVGTTTRDSLTEINLSDCNKVTDQCLSFFKRC
GNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKLS
Download sequence
Identical sequences A0A0C4DGG3
ENSP00000437821 ENSP00000437821 ENSP00000476072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]