SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000438548 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000438548
Domain Number 1 Region: 10-230
Classification Level Classification E-value
Superfamily RNI-like 6.42e-24
Family 28-residue LRR 0.0047
Further Details:      
 
Domain Number 2 Region: 252-380
Classification Level Classification E-value
Superfamily RNI-like 0.000000288
Family 28-residue LRR 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000438548   Gene: ENSG00000140853   Transcript: ENST00000540182
Sequence length 387
Comment pep:known chromosome:GRCh37:16:57074600:57117436:1 gene:ENSG00000140853 transcript:ENST00000540182 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XELPLSSRRMRLTHCGLQEKHLEQLCKALGGSCHLGHLHLDFSGNALGDEGAARLAQLLP
GLGALQSLNLSENGLSLDAVLGLVRCFSTLQWLFRLDISFESQHILLRGDKTSRDMWATG
SLPDFPAAAKFLGFRQRCIPRSLCLSECPLEPPSLTRLCATLKDCPGPLELQLSCEFLSD
QSLETLLDCLPQLPQLSLLQLSQTGLSPKSPFLLANTLSLCPRVKKVDLRSLHHATLHFR
SNEEEEGVCCGLSANLLGDSGLRCLLECLPQVPISGLLDLSHNSISQESALYLLETLPSC
PRVREASVNLGSEQSFRIHFSREDQAGKTLRLSECSFRPEHVSRLATGLSKSLQLTELTL
TQCCLGQKQLAILLSLVGRPAGLFSLS
Download sequence
Identical sequences H0YFG4
ENSP00000438548 ENSP00000438548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]