SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439042 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439042
Domain Number 1 Region: 1-297
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.06e-94
Family GABA-aminotransferase-like 0.00000000004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439042   Gene: ENSG00000065154   Transcript: ENST00000539214
Sequence length 301
Comment pep:known chromosome:GRCh37:10:126085872:126107545:-1 gene:ENSG00000065154 transcript:ENST00000539214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFG
PFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQV
LFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGE
HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPSDVVTAVRGKGLLN
AIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILS
F
Download sequence
Identical sequences A0A2J8PBN8
ENSP00000439042 gi|284507298|ref|NP_001165285.1| ENSP00000439042 NP_001165285.1.87134 NP_001165285.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]