SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439071 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439071
Domain Number 1 Region: 15-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 79-131
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000248
Family Hairy Orange domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439071   Gene: ENSG00000163909   Transcript: ENST00000535435
Sequence length 300
Comment pep:known chromosome:GRCh37:1:40092154:40098672:-1 gene:ENSG00000163909 transcript:ENST00000535435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPLSTPSSSQMQARKKHRGIIEKRRRDRINSSLSELRRLVPTAFEKQGSSKLEKAEVL
QMTVDHLKMLHATGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLEGPSSRADPVRIR
LLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFFHSCPGLPALSNQLAILGRVPSPVLPGVS
SPAYPIPALRTAPLRRATGIILPARRNVLPSRGASSTRRARPLERPATPVPVAPSSRAAR
SSHIAPLLQSSSPTPPGPTGSAAYVAVPTPNSSSPGPAGRPAGAMLYHSWVSEITEIGAF
Download sequence
Identical sequences XP_005270802.1.92137 ENSP00000439071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]