SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439171 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000439171
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily RNI-like 0.000186
Family Rna1p (RanGAP1), N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439171   Gene: ENSG00000151743   Transcript: ENST00000541931
Sequence length 58
Comment pep:putative chromosome:GRCh37:12:31825104:31882044:-1 gene:ENSG00000151743 transcript:ENST00000541931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY
Download sequence
Identical sequences A0A2J8K0W8 A0A2J8WC72 F5H3D1 G3RRP7
ENSP00000439171 ENSP00000439171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]